PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G11080.1
Common NameLOC102716710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 25382.4 Da    PI: 7.8843
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G11080.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.69.3e-251056248
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                  rien   rqvtf+kRr+g+lKKA ELSvLCda++ +iifs +gkly+
  OB08G11080.1 10 RIENPVHRQVTFCKRRAGLLKKARELSVLCDADIGIIIFSAHGKLYD 56
                  8********************************************97 PP

2K-box49.61.7e-17881721699
         K-box  16 slqqelakLkkeienLqreqRhllGedLe.sLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                     +qe+  Lk+ei+ Lq+ +R + G+  +  ++++eL+ Le+ Le  + +iRs K+++++++i+ l+ ke +l+ +n+ L++k+ 
  OB08G11080.1  88 DPKQEAMVLKQEINLLQKGLRYIYGNRANeHMTVEELNALERYLEIWMYTIRSAKMQIMIQEIQALKSKEGMLKAANEILQEKIV 172
                   5689*********************998626****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.576161IPR002100Transcription factor, MADS-box
SMARTSM004323.5E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-27176IPR002100Transcription factor, MADS-box
CDDcd002651.55E-38274No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-231055IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.01286177IPR002487Transcription factor, K-box
PfamPF014861.5E-2188171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MARGKVQLRR IENPVHRQVT FCKRRAGLLK KARELSVLCD ADIGIIIFSA HGKLYDLATT  60
GTMEELIERY KSASCEQPNN GCGDHRMDPK QEAMVLKQEI NLLQKGLRYI YGNRANEHMT  120
VEELNALERY LEIWMYTIRS AKMQIMIQEI QALKSKEGML KAANEILQEK IVEQNGLIDV  180
GRMVADQQNG HFSTVPLIEE ITNPLTILSG YSTCRGSEMG YSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-15370268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-15370268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-15370268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-15370268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A2e-15370268Myocyte-specific enhancer factor 2A
3kov_B2e-15370268Myocyte-specific enhancer factor 2A
3kov_I2e-15370268Myocyte-specific enhancer factor 2A
3kov_J2e-15370268Myocyte-specific enhancer factor 2A
3mu6_A1e-15370268Myocyte-specific enhancer factor 2A
3mu6_B1e-15370268Myocyte-specific enhancer factor 2A
3mu6_C1e-15370268Myocyte-specific enhancer factor 2A
3mu6_D1e-15370268Myocyte-specific enhancer factor 2A
3p57_A2e-15370268Myocyte-specific enhancer factor 2A
3p57_B2e-15370268Myocyte-specific enhancer factor 2A
3p57_C2e-15370268Myocyte-specific enhancer factor 2A
3p57_D2e-15370268Myocyte-specific enhancer factor 2A
3p57_I2e-15370268Myocyte-specific enhancer factor 2A
3p57_J2e-15370268Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0033260.0AB003326.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:R3786.
GenBankAK0691220.0AK069122.1 Oryza sativa Japonica Group cDNA clone:J023004P21, full insert sequence.
GenBankAY5519250.0AY551925.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS220 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006659055.11e-167PREDICTED: MADS-box transcription factor 26
SwissprotA2YQK91e-158MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-158MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLJ3MPS91e-167J3MPS9_ORYBR; Uncharacterized protein
STRINGOB08G11080.11e-166(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-62AGAMOUS-like 12